Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Abf1p
Description DNA binding protein with possible chromatin-reorganizing activity involved in transcriptional activation, gene silencing, and DNA replication and repair
Aminoacid Sequence
Download FASTA
>YKL112W ABF1
MDKLVVNYYEYKHPIINKDLAIGAHGGKKFPTLGAWYDVINEYEFQTRCPIILKNSHRNK
HFTFACHLKNCPFKVLLSYAGNAASSETSSPSANNNTNPPGTPDHIHHHSNNMNNEDNDN
NNGSNNKVSNDSKLDFVTDDLEYHLANTHPDDTNDKVESRSNEVNGNNDDDADANNIFKQ
QGVTIKNDTEDDSINKASIDRGLDDESGPTHGNDSGNHRHNEEDDVHTQMTKNYSDVVND
EDINVAIANAVANVDSQSNNKHDGKDDDATNNNDGQDNNTNNDHNNNSNINNNNVGSHGI
SSHSPSSIRDTSMNLDVFNSATDDIPGPFVVTKIEPYHSHPLEDNLSLGKFILTKIPKIL
QNDLKFDQILESSYNNSNHTVSKFKVSHYVEESGLLDILMQRYGLTAEDFEKRLLSQIAR
RITTYKARFVLKKKKMGEYNDLQPSSSSNNNNNNDGELSGTNLRSNSIDYAKHQEISSAG
TSSNTTKNVNNNKNDSNDDNNGNNNNDASNLMESVLDKTSSHRYQPKKMPSVNKWSKPDQ
ITHSDVSMVGLDESNDGGNENVHPTLAEVDAQEARETAQLAIDKINSYKRSIDDKNGDGH
NNSSRNVVDENLINDMDSEDAHKSKRQHLSDITLEERNEDDKLPHEVAEQLRLLSSHLKE
VENLHQNNDDDVDDVMVDVDVESQYNKNTTHHNNHHSQPHHDEEDVAGLIGKADDEEDLS
DENIQPELRGQ* 
Transcription Factor
Binding site(s)
AGCCGTAAATAGTTATCTTCCAAG
RTCRYYYN{3}ACG
RTCRYBN{4}ACG
TCN{7}ACG
RTCRN{6}ACGNR
TCRTN{5}AYGA
TNNCGTNNNNNNTGAT
RTCaYtxxxxACGD
RTCaYtxtxtACGR
RTCAYxYSScACGA
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator