Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Aca1p
Description Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family, may regulate transcription of genes involved in utilization of non-optimal carbon sources
Aminoacid Sequence
Download FASTA
>YER045C ACA1
MDYKHNFATSPDSFLDGRQNPLLYTDFLSSNKELIYKQPSGPGLVDSAYNFHHQNSLHDR
SVQENLGPMFQPFGVDISHLPITNPPIFQSSLPAFDQPVYKRRISISNGQISQLGEDLET
VENLYNCQPPILSSKAQQNPNPQQVANPSAAIYPSFSSNELQNVPQPHEQATVIPEAAPQ
TGSKNIYAAMTPYDSNIKLNIPAVAATCDIPSATPSIPSGDSTMNQAYINMQLRLQAQMQ
TKAWKNAQLNVHPCTPASNSSVSSSSSCQNINDHNIENQSVHSSISHGVNHHTVNNSCQN
AELNISSSLPYESKCPDVNLTHANSKPQYKDATSALKNNINSEKDVHTAPFSSMHTTATF
QIKQEARPQKIENNTAGLKDGAKAWKRARLLERNRIAASKCRQRKKMSQLQLQREFDQIS
KENTMMKKKIENYEKLVQKMKKISRLHMQECTINGGNNSYQSLQNKDSDVNGFLKMIEEM
IRSSSLYDE* 
Transcription Factor
Binding site(s)
TGACGTCA
TTACGTAA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator