Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ace2p
Description Transcription factor that activates genes required for cytokinesis; phosphorylation by Cbk1p blocks nuclear exit of Ace2p during the M-to-G1 transition, causing its specific localization to daughter cell nuclei; phosphorylation by Cdc28p and Pho85p prevents nuclear import during cell cycle phases other than cytokinesis; part of the RAM network that regulates cellular polarity and morphogenesis
Aminoacid Sequence
Download FASTA
>YLR131C ACE2
MDNVVDPWYINPSGFAKDTQDEEYVQHHDNVNPTIPPPDNYILNNENDDGLDNLLGMDYY
NIDDLLTQELRDLDIPLVPSPKTGDGSSDKKNIDRTWNLGDENNKVSHYSKKSMSSHKRG
LSGTAIFGFLGHNKTLSISSLQQSILNMSKDPQPMELINELGNHNTVKNNNDDFDHIREN
DGENSYLSQVLLKQQEELRIALEKQKEVNEKLEKQLRDNQIQQEKLRKVLEEQEEVAQKL
VSGATNSNSKPGSPVILKTPAMQNGRMKDNAIIVTTNSANGGYQFPPPTLISPRMSNTSI
NGSPSRKYHRQRYPNKSPESNGLNLFSSNSGYLRDSELLSFSPQNYNLNLDGLTYNDHNN
TSDKNNNDKKNSTGDNIFRLFEKTSPGGLSISPRINGNSLRSPFLVGTDKSRDDRYAAGT
FTPRTQLSPIHKKRESVVSTVSTISQLQDDTEPIHMRNTQNPTLRNANALASSSVLPPIP
GSSNNTPIKNSLPQKHVFQHTPVKAPPKNGSNLAPLLNAPDLTDHQLEIKTPIRNNSHCE
VESYPQVPPVTHDIHKSPTLHSTSPLPDEIIPRTTPMKITKKPTTLPPGTIDQYVKELPD
KLFECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAK
KYICPCGKRFNREDALMVHRSRMICTGGKKLEHSINKKLTSPKKSLLDSPHDTSPVKETI
ARDKDGSVLMKMEEQLRDDMRKHGLLDPPPSTAAHEQNSNRTLSNETDAL* 
Transcription Factor
Binding site(s)
ACCAGC
VCCAGCa
gVCCAGCa
agaCCAGC
GCagaCCA
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator