Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Arg81p
Description Zinc-finger transcription factor of the Zn(2)-Cys(6) binuclear cluster domain type, involved in the regulation of arginine-responsive genes; acts with Arg80p and Arg82p
Aminoacid Sequence
Download FASTA
>YML099C ARG81
MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP
MQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP
PIEKISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKSLESSASISLSSLPSSST
ISFPIRHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDAL
LSAVTLQGHHLGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAASA
NDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEESRM
PKSMLELTSYSSDLPPELVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKT
LYFPRALMALGDLAGLGQSSNSRNALLNALLAVSCFHLQSKYPRNYKLQKYFLGLGIELR
NQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMK
LRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSS
EPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADSTPSSTTPPIFTNIATESYYNK
SDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPRKFNELSL
NFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSLNCQFL
QNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAAKLAESGV
GSYWGARQVMLEVWRRRKEDEPGDNWYSVYKDWEMNLMLS* 
Transcription Factor
Binding site(s)
WWN{3}YARNHN{3}VVCGR
AAGTACAGTTAATAACGA
AAGTACAGTTAATAACGG
AAGTGCAACTGACTGCGA
AATGGAAATGGATAGCGA
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator