Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Aro80p
Description Zinc finger transcriptional activator of the Zn2Cys6 family; activates transcription of aromatic amino acid catabolic genes in the presence of aromatic amino acids
Aminoacid Sequence
Download FASTA
>YDR421W ARO80
MSAKKRPSGNAAFELPKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIF
SSNKGTSNDLPPNSINAISLPSLGKSKQEIQNDSTSPILSDVPLSRKGISSEKSFKSEGM
KWKLELSSMQNALEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLKR
LSKSDSTNTLYENTADMLNHTLNTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPDSLLTK
EEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLGLDNGE
DGMRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYAND
PELNNVNARGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKVF
IVTHISETTSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNEDYLGNEKFYLNEILPDE
ESKLRWKRVFENSENDHDNEKNFLTDWEREFLNDEYVLYYSNKKDDTNLAQNHIPPFPLR
FSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYREL
LVPLSDVPFSLADRKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKTSRLNMN
EIVTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYLTLTGS
ELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKL
RKKSYLERPPLLRDGTTPLESNRESSLEGQDLTKKPIFSKRIGYNKTETTFEPSERPLTE
EINSNSQNSNDTSSKGIVDPFVEQNNDITTALLNNELFQGPSLSDEVTDWFGASEDIGLE
FVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNSNNINNDINNSRPITRK* 
Transcription Factor
Binding site(s)
tCGGxa
gxxaaxtcTCGGBWaBtxxD
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator