Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ash1p
Description Zinc-finger inhibitor of HO transcription; mRNA is localized and translated in the distal tip of anaphase cells, resulting in accumulation of Ash1p in daughter cell nuclei and inhibition of HO expression; potential Cdc28p substrate
Aminoacid Sequence
Download FASTA
>YKL185W ASH1
MSSLYIKTPLHALSAGPDSHANSSYYDNLLLPSFSNLSSNISRNNITTDNNINSASPRKY
SFHSLNVSPILSPISLANEILGKKSNTAPASPHHMDYNPISSLTPGNSPEFNKASLSQIS
FTNPLNYGSGLGFSSNSQPRLPLLDRLSSVSLSKRPERPQQSLPSLRHLQLLPSPLLQEN
AARFPDTSKRTSNWKTDLTHWCKDTNYQDYVKIREEVAHFKPLSIPNLTNNQNNDSFNYG
KELESTRSSKFHSPSKESFDRTKLIPSILEAKDQFKDLSNNAWSITPPVTPPMSPPTNRT
MERTTLRGVEASFFEGKSSNNDSIFNPIISEKLVQEVKHQRQLRGNSFPMPNASHKKTNS
FKALQIKKLLANRDILSNNSKSNVRKPSKNKISKQASNVFGNTARQLVMKLDNASYSSVS
ASSSPSPSTPTKSGKMRSRSSSPVRPKAYTPSPRSPNYHRFALDSPPQSPRRSSNSSITK
KGSRRSSGSSPTRHTTRVCVSCHSSDSPCWRPSWSPRKQDQLCNSCGLRYKKTHTRCLND
LCRKIPTKGEINIMKSNGIDKEFVPERNCEIEGYRCLFCNYITETVEN* 
Transcription Factor
Binding site(s)
YTGAT
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator