Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Azf1p
Description Zinc-finger transcription factor, involved in induction of CLN3 transcription in response to glucose; genetic and physical interactions indicate a possible role in mitochondrial transcription or genome maintenance
Aminoacid Sequence
Download FASTA
>YOR113W AZF1
MPPPTAQFMGPTQAGQNESQNQSSGEAGEQNQEHGQGPTPILNQSQPASSQPQHQQQRNE
SISYYTNFNQPRYSTDASINSFLNISDNVPVTSTGGPSSGGAYSNLPRLSTSSTHQPPDL
SQIGRGFSIVNNLFPQQQQLQNQHRQQQQQQQQQSHQQPPFKTPSFSTGLTGSSSQYQFL
PRNDNTSQPPSKRNSVYLGPNDGPDFEFFSMQQSQQPQFQPSSRRESNSMRPPLLIPAAT
TKSQSNGTNNSGNMNTNADYESFFNTGTNNSNSNQNPYFLSSRNNSLKFNPEDFDFQFKR
RNSFVRGTLDHSSQNAFIPESRLNSLSVNNKANGDPVADNVTNNMKGKSNEVDNDDGNDS
SNNNNNNNNNNNNENNNDNNNDNNDNSINSATSTNIPNQEDHSLASTDTTSNSRKDLKEI
EQRLRKHLNDEDNYSSAISRPLDKNDVIEGSEGLNKHIDESGMQPNIIKKRKKDDSTVYV
KNEMPRTDPPMSKDNSTSAEGAAMANFSGKEPPIPDISSVSDDATNLIGATKVDQLMLII
QARKKGFTEKVNTTQDGDLLFNQTMDILPPKSELVGGVEKPKGTQNTRAVKKHECPYCHR
LFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSR
KGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETLNALTAKLAEMNPSE
NIPLEERQLLEYFASIYKNSNRGIKGRGKGVGTKKSTISSPENHPASTILNPNTNANNAI
ANDSENNGNPEGNIDSSSNSNPGSHSMISPTQKDMGTLQSQFIQNNFNNSVNSSNPSNQP
IINYNYTTLPHSRLGSSSSSNTNNNNSNFSVGAAPGVLMAPTTNNDFSFNLDQSNDNERS
QQEQVRFKNINYKS* 
Transcription Factor
Binding site(s)
AAGAAAAA
AAAAGAAA
aAAAAGAAa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator