Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Cad1p
Description AP-1-like basic leucine zipper (bZIP) transcriptional activator involved in stress responses, iron metabolism, and pleiotropic drug resistance; controls a set of genes involved in stabilizing proteins; binds consensus sequence TTACTAA
Aminoacid Sequence
Download FASTA
>YDR423C CAD1
MGNILRKGQQIYLAGDMKKQMLLNKDGTPKRKVGRPGRKRIDSEAKSRRTAQNRAAQRAF
RDRKEAKMKSLQERVELLEQKDAQNKTTTDFLLCSLKSLLSEITKYRAKNSDDERILAFL
DDLQEQQKRENEKGTSTAVSKAAKELPSPNSDENMTVNTSIEVQPHTQENEKVMWNIGSW
NAPSLTNSWDSPPGNRTGAVTIGDESINGSEMPDFSLDLVSNDRQTGLEALDYDIHNYFP
QHSERLTAEKIDTSACQCEIDQKYLPYETEDDTLFPSVLPLAVGSQCNNICNRKCIGTKP
CSNKEIKCDLITSHLLNQKSLASVLPVAASHTKTIRTQSEAIEHISSAISNGKASCYHIL
EEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQLL* 
Transcription Factor
Binding site(s)
TTACTAA
TTACgTAAt
gaTTASTAAtM
TTABGTAA
aBGTAATT
BGTAATTa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator