Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Cat8p
Description Zinc cluster transcriptional activator necessary for derepression of a variety of genes under non-fermentative growth conditions, active after diauxic shift, binds carbon source responsive elements
Aminoacid Sequence
Download FASTA
>YMR280C CAT8
MANNNSDRQGLEPRVIRTLGSQALSGPSISNRTSSSEANPHFSKNVKEAMIKTASPTPLS
TPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERV
RELEAENKRLLALCDIKEQQISLVSQSRPQTSTDNTINGNFKHDLKDAPLNLSSTNIYLL
NQTVNKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLCDGVSCTNHLHVKPTSTSLNDPT
AISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFG
FNSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLDDDSAFVKRFQSTNLSE
FVDLKKFLISLKFNINSFSKQSEKPANDQDDELLSLTEIKELLHLFFKFWSNQVPILNND
HFLIYFNNFVEVVKHLSTENLETNNTTKSTVTTNHEIFALKLLMMLQMGLLVKIKMEKIK
YTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGDISA
IYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASLQLG
VPRLLKDFDIECALPISDVEYKDQLSMENEKADKKAKKIQLQGQVSSFSLQIIRFAKILG
NILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDEIRATNQR
NTETKFDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNVDNATKKKQSMFNNDSK
GATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINSMYLPLPLNVSRTLIRF
SLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIASWHTLKLFDMSINLLL
KAPNVKVERLDKFLEKKLNYYNRLMGLPPATTTSLKPLFGSQSKNSLENRQRTPNVKREN
PEHEYLYGNDSNNNNNSEAGHSPMTNTTNGNKRLKYEKDAKRNAKDGGISKGENAHNFQN
DTKKNMSTSNLFPFSFSNTDLTALFTHPEGPNCTNTNNGNVDVCNRASTDATDANIENLS
FLNMAPFLQTGNSNIGQNTIENKPMHMDAIFSLPSNLDLMKDNMDSKPEQLEPVIKQNPE
NSKNNQFHQKGKSTNMEKNNLSFNNKSNYSLTKLMRLLNNDNSFSNISINNFLYQNDQNS
ASADPGTNKKAVTNAGANFKPPSTGSNTSQGSILGSTKHGMDNCDFNDLGNFNNFMTNVN
YSGVDYDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDTTFNDDLDRSRMNA
REVLNPTDSILSQGMVSSVSTRNTSNQRSLSSGNDSKGDSSSQENSKSATGNQLDTPSTL
FQMRRTSSGPSASHRGPRRPQKNRYNTDRSKSSGGGSSNTDNVSDLFQWQNAK* 
Transcription Factor
Binding site(s)
NCCDTYNVNCCGN
YCCNYTNRRCCGN
tCCGG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator