Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cbf1p
Description Dual function helix-loop-helix protein; binds the motif CACRTG present at several sites including MET gene promoters and centromere DNA element I (CDEI); affects nucleosome positioning at this motif; associates with other transcription factors such as Met4p and Isw1p to mediate transcriptional activation or repression; associates with kinetochore proteins and required for efficient chromosome segregation
Aminoacid Sequence
Download FASTA
>YJR060W CBF1
MNSLANNNKLSTEDEEIHSARKRGYNEEQNYSEARKKQRDQGLLSQESNDGNIDSALLSE
GATLKGTQSQYESGLTSNKDEKGSDDEDASVAEAAVAATVNYTDLIQGQEDSSDAHTSNQ
TNANGEHKDSLNGERAITPSNEGVKPNTSLEGMTSSPMESTQQSKNDMLIPLAEHDRGPE
HQQDDEDNDDADIDLKKDISMQPGRRGRKPTTLATTDEWKKQRKDSHKEVERRRRENINT
AINVLSDLLPVRESSKAAILACAAEYIQKLKETDEANIEKWTLQKLLSEQNASQLASANE
KLQEELGNAYKEIEYMKRVLRKEGIEYEDMHTHKKQENERKSTRSDNPHEA* 
Transcription Factor
Binding site(s)
RTCACGTG
RTCACRTG
TCACGTT
gaxcxgtCACGTGactxxtcg
DxcxgatCACGTGaYxDgxxxa
CACGTGAYc
gCACGTGa
CACGTGAcc
axCAcgtg
CAcgtga
VCACgtG
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator