Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Cbf1p
Description Dual function helix-loop-helix protein; binds the motif CACRTG present at several sites including MET gene promoters and centromere DNA element I (CDEI); affects nucleosome positioning at this motif; associates with other transcription factors such as Met4p and Isw1p to mediate transcriptional activation or repression; associates with kinetochore proteins and required for efficient chromosome segregation
Aminoacid Sequence
Download FASTA
>YJR060W CBF1
MNSLANNNKLSTEDEEIHSARKRGYNEEQNYSEARKKQRDQGLLSQESNDGNIDSALLSE
GATLKGTQSQYESGLTSNKDEKGSDDEDASVAEAAVAATVNYTDLIQGQEDSSDAHTSNQ
TNANGEHKDSLNGERAITPSNEGVKPNTSLEGMTSSPMESTQQSKNDMLIPLAEHDRGPE
HQQDDEDNDDADIDLKKDISMQPGRRGRKPTTLATTDEWKKQRKDSHKEVERRRRENINT
AINVLSDLLPVRESSKAAILACAAEYIQKLKETDEANIEKWTLQKLLSEQNASQLASANE
KLQEELGNAYKEIEYMKRVLRKEGIEYEDMHTHKKQENERKSTRSDNPHEA* 
Transcription Factor
Binding site(s)
CACGTG
RTCACGTG
RTCACRTG
TCACGTT
VCACGtg
gaxcxgtCACGTGactxxtcg
DxcxgatCACGTGaYxDgxxxa
CACGTGAYc
gCACGTGa
CACGTGAcc
axCAcgtg
CAcgtga
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator