Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Cha4p
Description DNA binding transcriptional activator, mediates serine/threonine activation of the catabolic L-serine (L-threonine) deaminase (CHA1); Zinc-finger protein with Zn[2]-Cys[6] fungal-type binuclear cluster domain
Aminoacid Sequence
Download FASTA
>YLR098C CHA4
MMLEPSPPPLTTTVTPSLPSSLKKSVTDNDQNNNNVPRKRKLACQNCRRRRRKCNMEKPC
SNCIKFRTECVFTQQDLRNKRYSTTYVEALQSQIRSLKEQLQILSSSSSTIASNALSSLK
NNSDHGDAPNEKILKYGETAQSALPSSESNDENESDAFTKKMPSESPPPVGTNSIYPSNS
LSIIKKKTDGSTRYQQQQVSLKNLSRSPLILRSLSLFFKWLYPGHYLFIHRETFLSAFFG
DTNTKSYYCSEELVFAIAALGSLISYKSETELFQQSEVFYQRAKTIVLKKIFQLEDSSLA
ESSSSSKLAIIQTLLCLAFYDIGSGENPMAWYLSGLAFRIAHEIGLHLNPEAWSNVYEDE
LSIMDFEVRSRIYWGCYIADHLIAILFGRSTSLRLSNSTVPETDELPEIETGIEEYIYDP
KVILSTANPLKKLIVLSRITEIFASKIFSPNETLLQRSEYLAKFNLEVYNWRRDLPPELQ
WTKRSLMEMTDFNPTIAYVWFHYYIVLISYNKPFIYEIKQSRELVEGYVDELYYLLKVWK
NKFKTFEKATIYMIYSAILAIQCMKSNLIKKDRKQDFLNFLSAPTLNYELARKFIENSED
ALHNSETMDLLGTLSHGNDFALEYNFDFTLLNEIDMLIGGNTNDGLSK* 
Transcription Factor
Binding site(s)
CGGN{10}CCG
CGGN{10}CCA
gCGGa
cxxxVVgGCGGAgWtacHcc
gGCGGRGa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator