Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cha4p
Description DNA binding transcriptional activator, mediates serine/threonine activation of the catabolic L-serine (L-threonine) deaminase (CHA1); Zinc-finger protein with Zn[2]-Cys[6] fungal-type binuclear cluster domain
Aminoacid Sequence
Download FASTA
>YLR098C CHA4
MMLEPSPPPLTTTVTPSLPSSLKKSVTDNDQNNNNVPRKRKLACQNCRRRRRKCNMEKPC
SNCIKFRTECVFTQQDLRNKRYSTTYVEALQSQIRSLKEQLQILSSSSSTIASNALSSLK
NNSDHGDAPNEKILKYGETAQSALPSSESNDENESDAFTKKMPSESPPPVGTNSIYPSNS
LSIIKKKTDGSTRYQQQQVSLKNLSRSPLILRSLSLFFKWLYPGHYLFIHRETFLSAFFG
DTNTKSYYCSEELVFAIAALGSLISYKSETELFQQSEVFYQRAKTIVLKKIFQLEDSSLA
ESSSSSKLAIIQTLLCLAFYDIGSGENPMAWYLSGLAFRIAHEIGLHLNPEAWSNVYEDE
LSIMDFEVRSRIYWGCYIADHLIAILFGRSTSLRLSNSTVPETDELPEIETGIEEYIYDP
KVILSTANPLKKLIVLSRITEIFASKIFSPNETLLQRSEYLAKFNLEVYNWRRDLPPELQ
WTKRSLMEMTDFNPTIAYVWFHYYIVLISYNKPFIYEIKQSRELVEGYVDELYYLLKVWK
NKFKTFEKATIYMIYSAILAIQCMKSNLIKKDRKQDFLNFLSAPTLNYELARKFIENSED
ALHNSETMDLLGTLSHGNDFALEYNFDFTLLNEIDMLIGGNTNDGLSK* 
Transcription Factor
Binding site(s)
CGGN{10}CCG
CGGN{10}CCA
gCGGa
cxxxVVgGCGGAgWtacHcc
gGCGGRGa
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator