Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cin5p
Description Basic leucine zipper (bZIP) transcription factor of the yAP-1 family; physically interacts with the Tup1-Cyc8 complex and recruits Tup1p to its targets; mediates pleiotropic drug resistance and salt tolerance; nuclearly localized under oxidative stress and sequestered in the cytoplasm by Lot6p under reducing conditions
Aminoacid Sequence
Download FASTA
>YOR028C CIN5
MLMQIKMDNHPFNFQPILASHSMTRDSTKPKKMTDTAFVPSPPVGFIKEENKADLHTISV
VASNVTLPQIQLPKIATLEEPGYESRTGSLTDLSGRRNSVNIGALCEDVPNTAGPHIARP
VTINNLIPPSLPRLNTYQLRPQLSDTHLNCHFNSNPYTTASHAPFESSYTTASTFTSQPA
ASYFPSNSTPATRKNSATTNLPSEERRRVSVSLSEQVFNEGERYNNDGQLIGKTGKPLRN
TKRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDGLMKENSELKKMIESLKSKLKE* 
Transcription Factor
Binding site(s)
TTACTAA
gMTTAcgTaA
gMTTACGTAAK
tAATtAYV
TtAYVTAA
MBAATtAY
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator