Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cmr3p
Description Putative zinc finger protein; YPR013C is not an essential gene
Aminoacid Sequence
Download FASTA
>CMR3 YPR013C
MNFSLSKQSSEKQSSYTDKSRSPNIGMCTVNYKSNLPLQVSAVDQLSTGKGTQFYGHNSY
KNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPI
SMNATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASE
PNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSD
WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML
RHLKSHERKRNKVLNTT* 
Transcription Factor
Binding site(s)
GtaRATC
cGtaRATC
tGtaRATC
aaYGTARATCMctt
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator