Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Crz1p
Description Transcription factor that activates transcription of genes involved in stress response; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation
Aminoacid Sequence
Download FASTA
>YNL027W CRZ1
MSFSNGNMASYMTSSNGEEQSINNKNDIDDNSAYRRNNFRNSSNSGSHTFQLSDLDLDVD
MRMDSANSSEKISKNLSSGIPDSFDSNVNSLLSPSSGSYSADLNYQSLYKPDLPQQQLQQ
QQLQQQQQQQQQQQQQQQKQTPTLKVEQSDTFQWDDILTPADNQHRPSLTNQFLSPRSNY
DGTTRSSGIDSNYSDTESNYHTPYLYPQDLVSSPAMSHLTANNDDFDDLLSVASMNSNYL
LPVNSHGYKHISNLDELDDLLSLTYSDNNLLSASNNSDFNNSNNGIINTADTQNSTIAIN
KSKVGTNQKMLLTIPTSSTPSPSTHAAPVTPIISIQEFNEGHFPVKNEDDGTLQLKVRDN
ESYSATNNNNLLRPDDNDYNNEALSDIDRSFEDIINGRKLKLKKSRRRSSQTSNNSFTSR
RSSRSRSISPDEKAKSISANREKLLEMADLLPSSENDNNRERYDNDSKTSYNTINSSNFN
EDNNNNNLLTSKPKIESGIVNIKNELDDTSKDLGILLDIDSLGQFEQKVGFKNDDNHENN
DNGTFSVKKNDNLEKLDSVTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICS
ICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRR
CITPLYEEARQEKSGQES* 
Transcription Factor
Binding site(s)
CACCAGTCGGTGGCTGTGCGCTTG
GAATGGCTG
GGGTGGCTG
GNGGCKCA
GGGGCTG
GAGCCC
GDGGCKBxg
CAGCCAC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator