Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cup2p
Description Copper-binding transcription factor; activates transcription of the metallothionein genes CUP1-1 and CUP1-2 in response to elevated copper concentrations
Aminoacid Sequence
Download FASTA
>YGL166W CUP2
MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPSTTCGHCKELRRTKNFNPSGG
CMCASARRPAVGSKEDETRCRCDEGEPCKCHTKRKSSRKSKGGSCHRRANDEAAHVNGLG
IADLDVLLGLNGRSSDVDMTTTLPSLKPPLQNGEIKADSIDNLDLASLDPLEQSPSISME
PVSINETGSAYTTTNTALNDIDIPFSINELNELYKQVSSHNSHSQ* 
Transcription Factor
Binding site(s)
HTHNNGCTGD
GCGTCTTTTCCGCTGA
TCTTTTGCTG
TCTTTTTGCTG
TCTTTTTTGCTG
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator