Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cup9p
Description Homeodomain-containing transcriptional repressor of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription
Aminoacid Sequence
Download FASTA
>YPL177C CUP9
MNYNCEIQNRNSKNVDNQVSLPPIQVLFNSIEKRSMPELAFSNIEYSHGNLRSSTEEQNY
PAPVLLPQHHSIAYPAINSGGTSTTATPTASTVETSKTSSSAMDTQSQYGSSKKSKSASD
DAKPCYKSAPIYEIINKEKDAGAQYNRPFSDFVESKSRRKQNSGRRSNLPKETVQILNTW
LLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIFSDYYTLVNSIPNDNANNT
PVERVQNVSAYHNTLSATNNTMYDATSTCSTDYELSKRFAHAPVTRRKKLIDRLEELKKL
SNPDMN* 
Transcription Factor
Binding site(s)
DWtgtGtCa
WWtgTGTCA
txxxaWATGTGTCAHat
aWGTGtMD
gTGWCRWa
TGWCRWag
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator