Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Dal80p
Description Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Deh1p
Aminoacid Sequence
Download FASTA
>YKR034W DAL80
MVLSDSLKLPSPTLSAAAGVDDCDGEDHPTCQNCFTVKTPLWRRDEHGTVLCNACGLFLK
LHGEPRPISLKTDTIKSRNRKKLNNNNVNTNANTHSNDPNKIFKRKKRLLTTGGGSLPTN
NPKVSILEKFMVSGSIKPLLKPKETVPNTKECSTQRGKFSLDPCEPSGKNYLYQINGSDI
YTSNIELTRLPNLSTLLEPSPFSDSAVPEIELTWKLHNEEEVIKLKTKISELELVTDLYK
KHIFQLNEKCKQLEVELHSRASVQSHPQH* 
Transcription Factor
Binding site(s)
GATAAGN{15,20}GATAAG
cGATAAG
cGATAWS
cxcGATAD
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator