Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Dal80p
Description Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Deh1p
Aminoacid Sequence
Download FASTA
>YKR034W DAL80
MVLSDSLKLPSPTLSAAAGVDDCDGEDHPTCQNCFTVKTPLWRRDEHGTVLCNACGLFLK
LHGEPRPISLKTDTIKSRNRKKLNNNNVNTNANTHSNDPNKIFKRKKRLLTTGGGSLPTN
NPKVSILEKFMVSGSIKPLLKPKETVPNTKECSTQRGKFSLDPCEPSGKNYLYQINGSDI
YTSNIELTRLPNLSTLLEPSPFSDSAVPEIELTWKLHNEEEVIKLKTKISELELVTDLYK
KHIFQLNEKCKQLEVELHSRASVQSHPQH* 
Transcription Factor
Binding site(s)
GATAAGN{15,20}GATAAG
cGATAAG
cGATAWS
cxcGATAD
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator