Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Dal82p
Description Positive regulator of allophanate inducible genes; binds a dodecanucleotide sequence upstream of all genes that are induced by allophanate; contains an UISALL DNA-binding, a transcriptional activation, and a coiled-coil domain
Aminoacid Sequence
Download FASTA
>YNL314W DAL82
MDESVDPVELLLRLLIRHKPHLKPYAYRQDSWQRVLDEYNRQTGSRYRQSRTLKTKFRRL
KDLFSADRAQFSPSQLKLMGALLDEAPEHPRPRTKFGNESSSSLSSSSFIKSHPGPDPFQ
QLSSAEHPNNHSSDDEHSGSQPLPLDSITIGIPPTLHTIPMILSKDNDVGKVIKSPKINK
GTNRFSETVLPPQMAAEQSWSDSNMELEICLDYLHNELEVIKKRQEDFECKVLNKLNIIE
ALLSQMRPPSQGDKI* 
Transcription Factor
Binding site(s)
SAAAWNTGCGBT
GAAAATTGCGTT
aaWgYGCGc
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator