Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Dal82p
Description Positive regulator of allophanate inducible genes; binds a dodecanucleotide sequence upstream of all genes that are induced by allophanate; contains an UISALL DNA-binding, a transcriptional activation, and a coiled-coil domain
Aminoacid Sequence
Download FASTA
>YNL314W DAL82
MDESVDPVELLLRLLIRHKPHLKPYAYRQDSWQRVLDEYNRQTGSRYRQSRTLKTKFRRL
KDLFSADRAQFSPSQLKLMGALLDEAPEHPRPRTKFGNESSSSLSSSSFIKSHPGPDPFQ
QLSSAEHPNNHSSDDEHSGSQPLPLDSITIGIPPTLHTIPMILSKDNDVGKVIKSPKINK
GTNRFSETVLPPQMAAEQSWSDSNMELEICLDYLHNELEVIKKRQEDFECKVLNKLNIIE
ALLSQMRPPSQGDKI* 
Transcription Factor
Binding site(s)
SAAAWNTGCGBT
GAAAATTGCGTT
aaWgYGCGc
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator