Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Dot6p
Description Protein involved in rRNA and ribosome biogenesis; binds polymerase A and C motif; subunit of the RPD3L histone deacetylase complex; similar to Tod6p; has chromatin specific SANT domain; involved in telomeric gene silencing and filamentation
Aminoacid Sequence
Download FASTA
>YER088C DOT6
MSISTSLNSASIHLSSMDTHPQLHSLTRQPHSSSTAMSKNEAQESSPSLPASSSSSTSAS
ASASSKNSSKNPSSWDPQDDLLLRHLKEVKKMGWKDISQYFPNRTPNACQFRWRRLKSGN
LKSNKTALIDINTYTGPLKITHGDETANAQQKPSKKVEENVLTEDTAEFTTTSSIPIPSR
KTSLPSFHASMSFSQSPSNVTPTTIVSNAASSMPFAPPTLPAALPHHPHQHLHHHPHHKT
LKPRSNSHSFTNSLNQDPIVRSNDEEKYGFIPKVFVRSRRSSFAYPQQVAITTTPSSPNS
SHVLLSSKSRRGSLANWSRRSSFNVSSNNTSRRSSMILAPNSVSNIFNVNNSGSNTASTS
NTNSRRESVIKKEFQQRLNNLSNSGGPTSNNGPIFPNSYTFMDLPHSSSVSSSSTLHKSK
RGSFSGHSMKSSCNPTNLWSKDEDALLMENKKRNLSVMELSILLPQRTEVEIQWRLNALS
SDADMLSPTHSPQKTLSKKTCPRMFKSGSTTDDDKGSDKEDVMGDGSNDDDEDNVDPLHR
AKQSSNKTVFSSSSSNISSKDVSPDPIFSPDPADDSSNTSDAGSRCTITSDTSSSAATMN
RTPNSKNPQDIALLNNFRSEAITPRPKPSSTTTSITTETTNNMINHSSSTTTTTNNSPLP
SINTIFKDML* 
Transcription Factor
Binding site(s)
gcGATGag
axgaxgCGATGAGStgH
cGATG
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator