Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ecm22p
Description Sterol regulatory element binding protein, regulates transcription of sterol biosynthetic genes; contains Zn[2]-Cys[6] binuclear cluster; homologous to Upc2p; relocates from intracellular membranes to perinuclear foci on sterol depletion
Aminoacid Sequence
Download FASTA
>YLR228C ECM22
MTSDDGNAGQEREKDAELIEVGGKKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEGKPF
CKKCTNMKLDCVYSPIQPRRRKDSSSSKFASAVHDRVGKKNLSDNAIMLQQQQQQLHHQQ
EQQFRQQQQVQLQQQLLPHVGTDEQSNSPNSVPPSVSNNMENLLLPHLLASLVNNTSNST
NSSANGAEAHNNITQTAPSSMINNNHPNMALPGNSPLSIPITPSFQSTAMNLSSSLNGLL
SPGRLNSVTNGLQQPQLQQQNQQIPQQQGTQSPFSNIPFDQLAQLNKMGLNFNMKSFNTL
FPYGAANGMASEFQELFGLGKFATSNNRAIKVSTAEEALANMQQEQEDKNKQFTKNPLDN
TKTDAVNSGNNPLNGNENKVTASDILSHNKNLIIDNTGLTISPPHTLSKPSIDQNIASPS
TGVSNVTSTKSLLSIPDNRTALGNSPTLKTSPMGDLLSNSEALSPRSSNSHTQQQSSPHS
NASSASRLVPELVGLSRKSNLNLIDLKLFHHYCTDVWHTITEAGISGPEVWSTYIPDLAF
HFPFLMHTILAFSATHLSRTEAGLDNYVSSHRLEALRLLREAVLEISDDNTDALVASALI
LILDSLANASSSSPTAWIFHVKGAVTILTAVWPLSETSKFYNLISVDLSDLGEAVINQSN
HNNDNDNSNNGDGNNNNTISELVCFDESIADLYPVEIDSPYLITLAYLDKLHREKNQLDF
MLRVFSFPALLDRTFLALLMTGDLGAMRIMRSYYTLLRGYTTEIKDKVWFLDSVSQVLPQ
DVDEYSGGGGMHMMLDFLGGGLPSMTTTNFSAFM* 
Transcription Factor
Binding site(s)
TCGTATA
tcCGGgtxDcCGGAVxH
cCTCGTWTAa
HtCCGGA
TCGTWCCT
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator