Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ecm23p
Description Non-essential protein of unconfirmed function; affects pre-rRNA processing, may act as a negative regulator of the transcription of genes involved in pseudohyphal growth; homologous to Srd1p
Aminoacid Sequence
Download FASTA
>YPL021W ECM23
MLYNKEQGTSGASSSGRRTKFHFDRFVQMVLFIAANPNYCCSVASIPKSGVTPDLKRADI
LEQKIKSLNSALSPKLKEESRLGGPLHNPSILPAPSFSSLPISSNGKKSLAGYRPKSRKK
QTILPNGQPKECATCGDTWTSQWRSGPNGNVELCSRCGIAYRKKMEKKIRSQQSSDDGTK
NFIFKNK* 
Transcription Factor
Binding site(s)
aGATCt
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator