Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Eds1p
Description Putative zinc cluster protein; YBR033W is not an essential gene
Aminoacid Sequence
Download FASTA
>YBR033W EDS1
MSHHVPNLYGTPIRDPHERKRNSASMGEVNQSVSSRNCERGSEKGTKQRKKASHACDQCR
RKRIKCRFDKHTGVCQGCLEVGEKCQFIRVPLKRGPAKKRGSVVSIEKFSSDNDPLQYRP
RTHSYPMNSGNNYLPSLARNSSFPSISSLFVPSITAQSQQFVKVPYDDIKRRSSLAILGS
DSSISTEFGGNYRLDENLNVRQEGKDIVAKGMITPVEEMGACSSNVRRQGSQSLPIQEQR
ASPYINPFISGRSRLSSLSYTSEATTSEGNTQGKNQCMLTPNSVRSIEKERLNSLTAGFP
NKKLGTDGRSDKWDKNSTWKPVYRSSNPSHPSTEKNVSLNQEASAKPLMLGTYRQFDATS
FYKVLGIYYNFFHINFPVIPINKSKFTDMLDPEKPNVIDEIRQINNEIIQCFKTALEVLV
FCKIKQRRSSKSTKSWSRDSLCDFQKGLYYIQNFNKCIADCFQSLITIKPVLKQNSSVIP
SRIKFIYFSTIIVLNFILILAGEESSLLLGPSVGVFNEFQAHKLFLPFQNTSPMLLLNSN
EESGDEILDYAVLFKRLYILLNILDTLQSFRLGQPKLINLNFGSAIETYFSDKTGHNQVV
EKAPVALDNILRNLKLGEFITYFVLNRKSLQVNVPHHLLFTNQTDYGEFAVEKGEHDNIA
GKFETLLKKKEILIRKLLNIEQKNDHILENCCNSDAEMKNIGELVCSMITLVSGILDSIT
NMNAENSVDLDSKPLPNAYFAQDSEEELMSPTQSITSNLASEENTRCTTKDLMGTVSIFM
LPMVEECYNIISLIGPIPTTLISLYIRNGNMAKGINDRIMTLSTALNELVQITALFNTLE
PFRKNAHDRAKRYYVSATSSTGCYESVMKSMYSGKCAASNASNVAPSEEENKKILKKFAD
IGWKLMDDSELGCCCCFFN* 
Transcription Factor
Binding site(s)
cCGGAWaAWYt
cGGAAaAAt
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator