Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ert1p
Description Transcriptional regulator of nonfermentable carbon utilization; GFP-fusion protein localizes to cytoplasm, nucleus; null mutation affects periodicity of transcriptional and metabolic oscillation; plays role in restricting Ty1 transposition
Aminoacid Sequence
Download FASTA
>YBR239C ERT1
MCTPDENDYKTSTDPDTSANTNHTLEKKKRKKRKNTNVACVNCSRLHVSCEAKRPCLRCI
SKGLTATCVDAPRKKSKYLAGIPNRELPMNIQPDLPPRKIMIPIYNNSSNSSLNVNNMGE
QQKFTSPQHIVHKAKFLSNAADSEYSILSNIIYQDTLSNKIPIDILYSNTNSTSNSTIGN
SSNNSPTGTNTSPEETEMEKIRQLYSEQRANIPPHPYPSSNQNVYSILLGPNSAKIVASQ
VNLFANHFPLVPVDSADNSLNFKRLLPRDPSEKSSQINWDSSINQYYLNSETVTFPELAI
PLKRRKNHLVSVSLESCSPDAANIKSNVEWEHSLRYSTPMEIYTSINAPFSHTPGFHHLL
VYLKHRFNQQDLVKMCRSIAEFRPIFIACSVTLTEEDMIFMEQCYQRTLLEYVKFIAQIG
TPTCIWRRNGQISYVNEEFEILCGWTREELLNKMTFIVEIMDDESVRDYFKTLSKVAYRD
FRGSEKMKVCRLLSPIKGKIIHCCCMWTLKRDVSGLPLMILGNFMPILN* 
Transcription Factor
Binding site(s)
CGGaa
aYCGGAAc
axxTTCCGGAAC
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator