Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Fkh1p
Description Forkhead family transcription factor with a minor role in the expression of G2/M phase genes; negatively regulates transcriptional elongation; positive role in chromatin silencing at HML and HMR; regulates donor preference during switching
Aminoacid Sequence
Download FASTA
>YIL131C FKH1
MSVTSREQKFSGKYSSYTAQDRQGLVNAVTCVLSSSSDPVAVSSDYSNSLSIAREVNAYA
KIAGCDWTYYVQKLEVTIGRNTDSLNLNAVPGTVVKKNIDIDLGPAKIVSRKHAAIRFNL
ESGSWELQIFGRNGAKVNFRRIPTGPDSPPTVLQSGCIIDIGGVQMIFILPEQETIISDY
CLNHLMPKLLSTYGTNGNNNPLLRNIIEGSTYLREQRLQEEARLQQLDHLHTPLSSSSDV
NPIGDPHGDTIMMEEDEEDENYTRGGIRPNTYTSSSNNAVTNGNVPHIENPSDLSLDENR
YIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKA
FEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRRGASVTRQLQLHMSKFGEIP
APESSSIDPRGIKAQKVKKSLQATSSILGESAPQLQRTQLTGQISTTTSMDVTTNANVNN
SSLS* 
Transcription Factor
Binding site(s)
GTMAACAA
RTAAAYAA
RYMAAYA
RYAAACAWW
aaDtGTAAACAAagxxga
gtaaAcAaa
AAACA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator