Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Fkh2p
Description Forkhead family transcription factor with a major role in the expression of G2/M phase genes; positively regulates transcriptional elongation; negative role in chromatin silencing at HML and HMR; substrate of the Cdc28p/Clb5p kinase
Aminoacid Sequence
Download FASTA
>YNL068C FKH2
MSSSNFNEMNELNMTQTNYGSTKYTAQHHQGVINAIISSLTAPDQPTTVSLQYSNDKNMA
TEIQAYAKLSGPNWTYYVKDLEVSIGRNTDPLNSALQENSDGVKNSYRVNIDLGPAKVVS
RKHAIIKYNMNIGGWELHILGRNGAKVNFQRTHNGPNNPPIRLSSGTLLDIGGTQMMFIL
PDSDPVVAPICIEHLMPNLINMFGLEGNNNPLLRDIIKQSNYAKQRQLTSNQQIKGFKLY
GSGGNAPFGSGANLGPSEQGIFNNNNNSKNKNGYFTSINPNYTASTTTSNTINPQAASPQ
GPPNTIIAANFVDSYKSSNAYPQALDFTSDLSHDENRNVKPPHSYATMITQAILSSPEGV
ISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESY
QQEFLNKWNTGKVGKIRRGSSVARQLQLHMAKFNSLPMEMDYRLSLNMAQPPKRQLQSHN
VLEPSNNNIIEGFVQHVPSKGNLPASQQSQPPVSHQNQSQQPPPQEQRQEIQFTFADTQN
RNIALARPIKTPQLQAPNSNANLNQNNMKEYKESLHPPAISISQMNRQSPNNALVSFTNA
CANSKIINNISDSADKSTNNNGGTKMNLPAISTSSLDENGNLEPTTTTSSGNSNSVPQTG
TTTSSLAANSLRLSQPYDTLLRSPTKAFHITAMEAYTPERGSANRARSPLHSNSNNTNNN
GANNSNLQTSGMENKQTGLVLDSNVLKSMESNNDNRRLTPSTSKSQNVKSSPGVWNLLQF
SSTNNTPAADSGGNKRGFSINPDIKAKENENATSEKDSDSNSNDLETKDINSSPLKNQGG
STANAKELILDTDGAKISIINN* 
Transcription Factor
Binding site(s)
GTMAACAA
RTAAAYAA
RYMAAYA
RYAAACAWW
aaaGTAAACAAagxxgV
gtaaaca
taaaca
AAACA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator