Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Gat1p
Description Transcriptional activator of genes involved in nitrogen catabolite repression; contains a GATA-1-type zinc finger DNA-binding motif; activity and localization regulated by nitrogen limitation and Ure2p
Aminoacid Sequence
Download FASTA
>YFL021W GAT1
MHVFFPLLFRPSPVLFIACAYIYIDIYIHCTRCTVVNITMSTNRVPNLDPDLNLNKEIWD
LYSSAQKILPDSNRILNLSWRLHNRTSFHRINRIMQHSNSIMDFSASPFASGVNAAGPGN
NDLDDTDTDNQQFFLSDMNLNGSSVFENVFDDDDDDDDVETHSIVHSDLLNDMDSASQRA
SHNASGFPNFLDTSCSSSFDDHFIFTNNLPFLNNNSINNNHSHNSSHNNNSPSIANNTNA
NTNTNTSASTNTNSPLLRRNPSPSIVKPGSRRNSSVRKKKPALKKIKSSTSVQSSATPPS
NTSSNPDIKCSNCTTSTTPLWRKDPKGLPLCNACGLFLKLHGVTRPLSLKTDIIKKRQRS
STKINNNITPPPSSSLNPGAAGKKKNYTASVAASKRKNSLNIVAPLKSQDIPIPKIASPS
IPQYLRSNTRHHLSSSVPIEAETFSSFRPDMNMTMNMNLHNASTSSFNNEAFWKPLDSAI
DHHSGDTNPNSNMNTTPNGNLSLDWLNLNL* 
Transcription Factor
Binding site(s)
GATAAG
GATaa
cVcGATAAGVaDa
cHGATAAG
HGATa
DcVHGATa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator