Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Gcr1p
Description Transcriptional activator of genes involved in glycolysis; DNA-binding protein that interacts and functions with the transcriptional activator Gcr2p
Aminoacid Sequence
Download FASTA
>YPL075W GCR1
MVCTSTSSNFYSIAQYILQSYFKVNVDSLNSLKLVDLIVDQTYPDSLTLRKLNEGATGQP
YDYFNTVSRDADISKCPIFALTIFFVIRWSHPNPPISIENFTTVPLLDSNFISLNSNPLL
YIQNQNPNSNSSVKVSRSQTFEPSKELIDLVFPWLSYLKQDMLLIDRTNYKLYSLCELFE
FMGRVAIQDLRYLSQHPLLLPNIVTFISKFIPELFQNEEFKGIGSIKNSNNNALNNVTGI
ETQFLNPSTEEVSQKVDSYFMELSKKLTTENIRLSQEITQLKADMNSVGNVCNQILLLQR
QLLSGNQAIGSKSENIVSSTGGGILILDKNSINSNVLSNLVQSIDPNHSKPNGQAQTHQR
GPKGQSHAQVQSTNSPALAPINMFPSLSNSIQPMLGTLAPQPQDIVQKRKLPLPGSIASA
ATGSPFSPSPVGESPYSKRFKLDDKPTPSQTALDSLLTKSISSPRLPLSTLANTAVTESF
RSPQQFQHSPDFVVGGSSSSTTENNSKKVNEDSPSSSSKLAERPRLPNNDSTTSMPESPT
EVAGDDVDREKPPESSKSEPNDNSPESKDPEKNGKNSNPLGTDADKPVPISNIHNSTEAA
NSSGTVTKTAPSFPQSSSKFEIINKKDTKAGPNEAIKYKLSRENKTIWDLYAEWYIGLNG
KSSIKKLIENYGWRRWKVSEDSHFFPTRRIIMDYIETECDRGIKLGRFTNPQQPREDIRK
ILVGDLEKFRINNGLTLNSLSLYFRNLTKNNKEICIFENFKNWNVRSMTEEEKLKYCKRR
HNTPS* 
Transcription Factor
Binding site(s)
CTTCC
CWTCC
tAxWgGAagCYS
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator