Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Gln3p
Description Transcriptional activator of genes regulated by nitrogen catabolite repression (NCR), localization and activity regulated by quality of nitrogen source
Aminoacid Sequence
Download FASTA
>YER040W GLN3
MQDDPENSKLYDLLNSHLDVHGRSNEEPRQTGDSRSQSSGNTGENEEDIAFASGLNGGTF
DSMLEALPDDLYFTDFVSPFTAAATTSVTTKTVKDTTPATNHMDDDIAMFDSLATTQPID
IAASNQQNGEIAQLWDFNVDQFNMTPSNSSGSATISAPNSFTSDIPQYNHGSLGNSVSKS
SLFPYNSSTSNSNINQPSINNNSNTNAQSHHSFNIYKLQNNNSSSSAMNITNNNNSNNSN
IQHPFLKKSDSIGLSSSNTTNSVRKNSLIKPMSSTSLANFKRAASVSSSISNMEPSGQNK
KPLIQCFNCKTFKTPLWRRSPEGNTLCNACGLFQKLHGTMRPLSLKSDVIKKRISKKRAK
QTDPNIAQNTPSAPATASTSVTTTNAKPIRSRKKSLQQNSLSRVIPEEIIRDNIGNTNNI
LNVNRGGYNFNSVPSPVLMNSQSYNSSNANFNGASNANLNSNNLMRHNSNTVTPNFRRSS
RRSSTSSNTSSSSKSSSRSVVPILPKPSPNSANSQQFNMNMNLMNTTNNVSAGNSVASSP
RIISSANFNSNSPLQQNLLSNSFQRQGMNIPRRKMSRNASYSSSFMAASLQQLHEQQQVD
VNSNTNTNSNRQNWNSSNSVSTNSRSSNFVSQKPNFDIFNTPVDSPSVSRPSSRKSHTSL
LSQQLQNSESNSFISNHKFNNRLSSDSTSPIKYEADVSAGGKISEDNSTKGSSKESSAIA
DELDWLKFGI* 
Transcription Factor
Binding site(s)
GATAAG
GATTAG
GATWa
HGATaa
tattgctGATAAgGccxHaa
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator