Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Gsm1p
Description Putative zinc cluster protein of unknown function; proposed to be involved in the regulation of energy metabolism, based on patterns of expression and sequence analysis
Aminoacid Sequence
Download FASTA
>YJL103C GSM1
MTKKLPSELKQTRKSIQTACEFCHTKHIQCDVGRPCQNCLKRNIGKFCRDKKRKSRKRIE
KHGTQPYLNLGKRLVIHDVPSKTVSPSSVHLQRDFLSSDQEKPGKTPAHNTNIQYTYNIN
DNFQSAGSIPRITNFNTNNRQTVLENTSNNISASQAVHLMNDPIIPTVRKSTLNLKSHFL
EQHKAMQQPLATNCLVATSNVPVHSGMDDSNKSDDDVDDETNIHFDSMWCNDEYMKLKDI
VDISTPFLPNNSQIFSLQESEYPNPSASTRGNSSLHLTNLLNSTKSVNDQKDSSIGHSTS
TFNTYDEVVSRPFISLDMLHLNRGANANTHPSHNAKLESECDSSSHSDADLEKHDTDFIS
PSKFRELVKTPQDLYDNKCLIKPHNYKLAYTKLLTTLRKKFLEGAEIDKSASVKDEHSTQ
KHNLRYDLEVIIRSILERYAPIFISLTSNMIEEDLLLQEVTLQRALLDLENMAKLVSCTP
MCIWRRSGEICFVSNEFYSLTGFNKNLLLDRTSFIFEYLDHKSVSNYFQIFNELLAFGYN
DINKRKKLLMLNACSSTSSKITEGFSFTTDGKAIFTKCNLLLSNGLYLKCACCWTVKRDS
FNIPILVMGQFLPIFEMD* 
Transcription Factor
Binding site(s)
CGGNNNNNNNNCGG
CGGNNNNNNNNNCGG
axctCCG
ctCCG
txaxxWAaCTCCGGagtD
axctCCGGag
CCGxxxxxxxxxCCG
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator