Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Gzf3p
Description GATA zinc finger protein and Dal80p homolog that negatively regulates nitrogen catabolic gene expression by competing with Gat1p for GATA site binding; function requires a repressive carbon source; dimerizes with Dal80p and binds to Tor1p
Aminoacid Sequence
Download FASTA
>YJL110C GZF3
MASQATTLRGYNIRKRDNVFEPKSSENLNSLNQSEEEGHIGRWPPLGYEAVSAEQKSAVQ
LRESQAGASISNNMNFKANDKSFSTSTAGRMSPDTNSLHHILPKNQVKNNGQTMDANCNN
NVSNDANVPVCKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKSRNR
KSNTNHAHNLDNFRNQTLIAELKGDCNIESSGRKANRVTSEDKKKKSSQLLMGTSSTAKI
SKKPKTESKERSDSHLSATKLEVLMSGDCSRPNLKPKLPKQDTAIYQEKLLTFPSYTDVK
EYSNSAHQSAFIKERSQFNAASFPLNASHSVTSKTGADSPQLPHLSMLLGSLSSTSISNN
GSEIVSNCNNGIASTAATLAPTSSRTTDSNPSEVPNQIRSTMSSPDIISAKRNDPAPLSF
HMASINDMLETRDRAISNVKTETTPPHFIPFLQSSKAPCISKANSQSISNSVSSSDVSGR
KFENHPAKDLGDQLSTKLHKEEEIIKLKTRINELELVTDLYRRHINELDGKCRALEERLQ
RTVKQEGNKGG* 
Transcription Factor
Binding site(s)
GATAAG
gAtaa
HGATaag
txxxxgctGATAAGgga
HGATAaSa
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator