Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Gzf3p
Description GATA zinc finger protein and Dal80p homolog that negatively regulates nitrogen catabolic gene expression by competing with Gat1p for GATA site binding; function requires a repressive carbon source; dimerizes with Dal80p and binds to Tor1p
Aminoacid Sequence
Download FASTA
>YJL110C GZF3
MASQATTLRGYNIRKRDNVFEPKSSENLNSLNQSEEEGHIGRWPPLGYEAVSAEQKSAVQ
LRESQAGASISNNMNFKANDKSFSTSTAGRMSPDTNSLHHILPKNQVKNNGQTMDANCNN
NVSNDANVPVCKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKSRNR
KSNTNHAHNLDNFRNQTLIAELKGDCNIESSGRKANRVTSEDKKKKSSQLLMGTSSTAKI
SKKPKTESKERSDSHLSATKLEVLMSGDCSRPNLKPKLPKQDTAIYQEKLLTFPSYTDVK
EYSNSAHQSAFIKERSQFNAASFPLNASHSVTSKTGADSPQLPHLSMLLGSLSSTSISNN
GSEIVSNCNNGIASTAATLAPTSSRTTDSNPSEVPNQIRSTMSSPDIISAKRNDPAPLSF
HMASINDMLETRDRAISNVKTETTPPHFIPFLQSSKAPCISKANSQSISNSVSSSDVSGR
KFENHPAKDLGDQLSTKLHKEEEIIKLKTRINELELVTDLYRRHINELDGKCRALEERLQ
RTVKQEGNKGG* 
Transcription Factor
Binding site(s)
GATAAG
gAtaa
HGATaag
txxxxgctGATAAGgga
HGATAaSa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator