Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Haa1p
Description Transcriptional activator involved in the transcription of TPO2, YRO2, and other genes putatively encoding membrane stress proteins; involved in adaptation to weak acid stress
Aminoacid Sequence
Download FASTA
>YPR008W HAA1
MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCDYCKQLRKNKNANPEGV
CTCGRLEKKKLAQKAKEEARAKAKEKQRKQCTCGTDEVCKYHAQKRHLRKSPSSSQKKGR
SISRSQPMFERVLSSTSLDSNMLSGHGALSDTSSILTSTFLDSEPGVGKISKDYHHVPSL
ASISSLQSSQSLDQNFSIPQSPPLSSMSFNFLTGNINETNQNHSNHQHSKSGNNWQDSSV
SLPAKADSRLNMMDKNNSVGLDLLGHSKRISPISNSRVGEVSVPLEEYIPSDIDGVGRVT
DKSSLVYDWPFDESIERNFSTTATAATGESKFDINDNCNRINSKSYSKTNSMNGNGMNNS
NNNNINSNGNDKNNNNSSRQEHQGNGLFDMFTDSSSISTLSRANLLLQEKIGSQENSVKQ
ENYSKNPQLRHQLTSRSRSFIHHPANEYLKNTFGNSHSNDIGKGVEVLSLTPSFMDIPEK
ERETERSPSSNYITDRPFTRKPRSSSIDVNHRYPPMAPTTVATSPGALNNAVASNLDDQL
SLTSLNSQPSSIANMMMDPSNLAEQSSIHSVPQSINSPRMPKTGSRQDKNIHTKKEERNP
LNNIHDLSQLENVPDEMNQMFSPPLKSMNRPDAIRENSSSSNFIIQGNSMISTPSGRNDL
PDTSPMSSIQTASPPSQLLTDQGFADLDNFMSSL* 
Transcription Factor
Binding site(s)
GGCGAGGGG
AGCGAGGGG
GGCCAGGGG
GGCGCGGGG
GGCGAGAGG
GGCGAGGGG
SMGGSG
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator