Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Haa1p
Description Transcriptional activator involved in the transcription of TPO2, YRO2, and other genes putatively encoding membrane stress proteins; involved in adaptation to weak acid stress
Aminoacid Sequence
Download FASTA
>YPR008W HAA1
MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCDYCKQLRKNKNANPEGV
CTCGRLEKKKLAQKAKEEARAKAKEKQRKQCTCGTDEVCKYHAQKRHLRKSPSSSQKKGR
SISRSQPMFERVLSSTSLDSNMLSGHGALSDTSSILTSTFLDSEPGVGKISKDYHHVPSL
ASISSLQSSQSLDQNFSIPQSPPLSSMSFNFLTGNINETNQNHSNHQHSKSGNNWQDSSV
SLPAKADSRLNMMDKNNSVGLDLLGHSKRISPISNSRVGEVSVPLEEYIPSDIDGVGRVT
DKSSLVYDWPFDESIERNFSTTATAATGESKFDINDNCNRINSKSYSKTNSMNGNGMNNS
NNNNINSNGNDKNNNNSSRQEHQGNGLFDMFTDSSSISTLSRANLLLQEKIGSQENSVKQ
ENYSKNPQLRHQLTSRSRSFIHHPANEYLKNTFGNSHSNDIGKGVEVLSLTPSFMDIPEK
ERETERSPSSNYITDRPFTRKPRSSSIDVNHRYPPMAPTTVATSPGALNNAVASNLDDQL
SLTSLNSQPSSIANMMMDPSNLAEQSSIHSVPQSINSPRMPKTGSRQDKNIHTKKEERNP
LNNIHDLSQLENVPDEMNQMFSPPLKSMNRPDAIRENSSSSNFIIQGNSMISTPSGRNDL
PDTSPMSSIQTASPPSQLLTDQGFADLDNFMSSL* 
Transcription Factor
Binding site(s)
GGCGAGGGG
GGCGAGAGG
GGCGCGGGG
GGCCAGGGG
AGCGAGGGG
SMGGSG
GAGGCG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator