Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Hap1p
Description Zinc finger transcription factor involved in the complex regulation of gene expression in response to levels of heme and oxygen; the S288C sequence differs from other strain backgrounds due to a Ty1 insertion in the carboxy terminus
Aminoacid Sequence
Download FASTA
>YLR256W HAP1
MSNTPYNSSVPSIASMTQSSVSRSPNMHTATTPGANTSSNSPPLHMSSDSSKIKRKRNRI
PLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRER
VKSLEKTLSKVHSSPSSNSLKSYNTPESSNLFMGSDEHTTLVNANTGSASSASHMHQQQQ
QQQQQEQQQDFSRSANANANSSSLSISNKYDNDELDLTKDFDLLHIKSNGTIHLGATHWL
SIMKGDPYLKLLWGHIFAMREKLNEWYYQKNSYSKLKSSKCPINHAQAPPSAAAAATRKC
PVDHSAFSSGMVAPKEETPLPRKCPVDHTMFSSGMIPPREDTSSQKRCPVDHTMYSAGMM
PPKDETPSPFSTKAMIDHNKHTMNPPQSKCPVDHRNYMKDYPSDMANSSSNPASRCPIDH
SSMKNTAALPASTHNTIPHHQPQSGSHARSHPAQSRKHDSYMTESEVLATLCEMLPPKRV
IALFIEKFFKHLYPAIPILDEQNFKNHVNQMLSLSSMNPTVNNFGMSMPSSSTLENQPIT
QINLPKLSDSCNLGILIIILRLTWLSIPSNSCEVDLGEESGSFLVPNESSNMSASALTSM
AKEESLLLKHETPVEALELCQKYLIKFDELSSISNNNVNLTTVQFAIFYNFYMKSASNDL
TTLTNTNNTGMANPGHDSESHQILLSNITQMAFSCGLHRDPDNFPQLNATIPATSQDVSN
NGSKKANPSTNPTLNNNMSAATTNSSSRSGSADSRSGSNPVNKKENQVSIERFKHTWRKI
WYYIVSMDVNQSLSLGSPRLLRNLRDFSDTKLPSASRIDYVRDIKELIIVKNFTLFFQID
LCIIAVLNHILNVSLARSVRKFELDSLINLLKNLTYGTENVNDVVSSLINKGLLPTSEGG
SVDSNNDEIYGLPKLPDILNHGQHNQNLYADGRNTSSSDIDKKLDLPHESTTRALFFSKH
MTIRMLLYLLNYILFTHYEPMGSEDPGTNILAKEYAQEALNFAMDGYRNCMIFFNNIRNT
NSLFDYMNVILSYPCLDIGHRSLQFIVCLILRAKCGPLTGMRESSIITNGTSSGFNSSVE
DEDVKVKQESSDELKKDDFMKDVNLDSGDSLAEILMSRMLLFQKLTKQLSKKYNYAIRMN
KSTGFFVSLLDTPSKKSDSKSGGSSFMLGNWKHPKVSNMSGFLAGDKDQLQKCPVYQDAL
GFVSPTGANEGSAPMQGMSLQGSTARMGGTQLPPIRSYKPITYTSSNLRRMNETGEAEAK
RRRFNDGYIDNNSNNDIPRGISPKPSNGLSSVQPLLSSFSMNQLNGGTIPTVPSLTNITS
QMGALPSLDRITTNQINLPDPSRDEAFDNSIKQMTPMTSAFMNANTTIPSSTLNGNMNMN
GAGTANTDTSANGSALSTLTSPQGSDLASNSATQYKPDLEDFLMQNSNFNGLMINPSSLV
EVVGGYNDPNNLGRNDAVDFLPVDNVEIDGVGIKINYHLLTSIYVTSILSYTVLEDDAND
EK* 
Transcription Factor
Binding site(s)
CGGN{3}TANCGG
CGGN{6}CGG
CGGN{3}TANCGGN{3}TA
TCGCGTTCATATATATCGGATATACTCTTGAGGCACAATT
CGCATTTATCGC
CCGaTAaHtCCGG
tAWcTCCG
TCGGCCGA
CCGNTATNTCC
CCGATA
CCGXTATXTCC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator