Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Hap4p
Description Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex, a transcriptional activator and global regulator of respiratory gene expression; provides the principal activation function of the complex
Aminoacid Sequence
Download FASTA
>YKL109W HAP4
MTAKTFLLQASASRPRSNHFKNEHNNIPLAPVPIAPNTNHHNNSSLEFENDGSKKKKKSS
LVVRTSKHWVLPPRPRPGRRSSSHNTLPANNTNNILNVGPNSRNSSNNNNNNNIISNRKQ
ASKEKRKIPRHIQTIDEKLINDSNYLAFLKFDDLENEKFHSSASSISSPSYSSPSFSSYR
NRKKSEFMDDESCTDVETIAAHNSLLTKNHHIDSSSNVHAPPTKKSKLNDFDLLSLSSTS
SSATPVPQLTKDLNMNLNFHKIPHKASFPDSPADFSPADSVSLIRNHSLPTNLQVKDKIE
DLNEIKFFNDFEKLEFFNKYAKVNTNNDVNENNDLWNSYLQSMDDTTGKNSGNYQQVDND
DNMSLLNLPILEETVSSGQDDKVEPDEEDIWNYLPSSSSQQEDSSRALKKNTNSEKANIQ
AKNDETYLFLQDQDESADSHHHDELGSEITLADNKFSYLPPTLEELMEEQDCNNGRSFKN
FMFSNDTGIDGSAGTDDDYTKVLKSKKISTSKSNANLYDLNDNNNDATATNELDQSSFID
DLDEDVDFLKVQVF* 
Transcription Factor
Binding site(s)
TNATTGGT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator