Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Hcm1p
Description Forkhead transcription factor that drives S-phase specific expression of genes involved in chromosome segregation, spindle dynamics, and budding; suppressor of calmodulin mutants with specific SPB assembly defects; telomere maintenance role
Aminoacid Sequence
Download FASTA
>YCR065W HCM1
MMNEDISIIDGHNSFLTEKSTVLLTQAKRTLEDEKEMITPPSSTVRKTMKEVNKRPSHPL
SPDHSSPIAPSKAKRQRSDTCARSNGNLTLEEILQSLERRRINGELAKKPPYSYATLICL
AILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCDGKGHF
WEVRPGAETKFFKGENRGYEFVKDSLQDIGKYFEIDSTLDELEQVESGEGNDDLPDEEER
EEAGKFPSIEIQLNSSPILRVSQLHHIPQLKTDNSVLNPHENLESMRNMIENDVNNIDSL
EPPYVMKKYHTSLGLPSLVNAKDHFQAGVKNNNITQANRFNTLPITSAKSPQNFRKYFTS
FNSNFEDLSPLRSNVGAGSLLDPLPYSPLKLYDQKNLALMSKPQSQQSYSNSQLPPPPSS
HGSDLLKTPKMRHSDGLEKTPSRLISTPKDGNSILRKWQTPSHLFEDLYCSPLFRAIETP
IRYITTPGGTLETQISPRKSSAPDVLTSATNSKFASSGLFGVDVYSVWKRATEKISDGNN
TTDSNQKHHPYHNHPSNDSGNEKN* 
Transcription Factor
Binding site(s)
WAAYAAACAAW
atMAACAa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator