Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Hcm1p
Description Forkhead transcription factor that drives S-phase specific expression of genes involved in chromosome segregation, spindle dynamics, and budding; suppressor of calmodulin mutants with specific SPB assembly defects; telomere maintenance role
Aminoacid Sequence
Download FASTA
>YCR065W HCM1
MMNEDISIIDGHNSFLTEKSTVLLTQAKRTLEDEKEMITPPSSTVRKTMKEVNKRPSHPL
SPDHSSPIAPSKAKRQRSDTCARSNGNLTLEEILQSLERRRINGELAKKPPYSYATLICL
AILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCDGKGHF
WEVRPGAETKFFKGENRGYEFVKDSLQDIGKYFEIDSTLDELEQVESGEGNDDLPDEEER
EEAGKFPSIEIQLNSSPILRVSQLHHIPQLKTDNSVLNPHENLESMRNMIENDVNNIDSL
EPPYVMKKYHTSLGLPSLVNAKDHFQAGVKNNNITQANRFNTLPITSAKSPQNFRKYFTS
FNSNFEDLSPLRSNVGAGSLLDPLPYSPLKLYDQKNLALMSKPQSQQSYSNSQLPPPPSS
HGSDLLKTPKMRHSDGLEKTPSRLISTPKDGNSILRKWQTPSHLFEDLYCSPLFRAIETP
IRYITTPGGTLETQISPRKSSAPDVLTSATNSKFASSGLFGVDVYSVWKRATEKISDGNN
TTDSNQKHHPYHNHPSNDSGNEKN* 
Transcription Factor
Binding site(s)
WAAYAAACAAW
atMAACAa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator