Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Hmra2p
Description Silenced copy of a2 at HMR; similarity to Alpha2p; required along with a1p for inhibiting expression of the HO endonuclease in a/alpha HO/HO diploid cells with an active mating-type interconversion system
Aminoacid Sequence
Download FASTA
>YCR096C HMRA2
MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN
IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE* 
Transcription Factor
Binding site(s)
cRTGTAAW
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator