Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Hot1p
Description Transcription factor required for the transient induction of glycerol biosynthetic genes GPD1 and GPP2 in response to high osmolarity; targets Hog1p to osmostress responsive promoters; has similarity to Msn1p and Gcr1p
Aminoacid Sequence
Download FASTA
>YMR172W HOT1
MSGMGIAILCIVRTKIYRITISFDYSTLMSPFFLFLMMPTTLKDGYRMNSQVNEDAIGIN
LDLSLPTHISPTTGSESASGSNASTLRNDGNALDGGLLRTSAAISAPTGTSQPTETIGEK
LSNEERVNSNVSASNSTTAGTGRMLSQSLTNDSPSNEISTDQLKIFQRMDEMSARMIEME
ESFNKLSNKIAEQNTMVLNLKQDNYKVMNKLNILLKLVAQPSARPSTNNAQNKLAIELLN
SISAVSSAYLQKMQNNGSGRQHTADLCTGDSNTHSGINQHRTTNGTIDVNTNTAQLNNQF
SNALNTILPDQQHNRNNVSQNINQSLPNRQLGPVINTQANQNQSQVLIHNTNTHQQVNRS
PISFPNASTDKPFKLNPNGIKRRRRNTQSNNNASTNDHASAAQKPISALSPLTNSHNSTT
SMNYTNSSIHSGVTSASNSFHDLNSLNNFGTTTALSLPSLALDNASFPPNQNVIPPIINN
TQQPLSFSQLINQDSTTSELLPSGKSGVNTNIVNRNRASTLPSYPKPMTVKSNVDDDGYQ
EDDDDDGDDEGDGRDNEEDSTAEEDEVDDEIETDMKNASINKRRRSLHHKKSNSLNGRRK
LHGESATKPNINSDLHYRILKAPTDVKTIWEEYDTGIRGKPSIKHLEAKYGNKWRLNKNK
KTFSRRKRLYKFILNGMERGKTAQEMIETLENKRLYKDDEDGEVKKRTIGWLQESLAGI* 
Transcription Factor
Binding site(s)
GGGACAAA
CATTTGGC
CACTTTGAC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator