Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Ino2p
Description Component of the heteromeric Ino2p/Ino4p basic helix-loop-helix transcription activator that binds inositol/choline-responsive elements (ICREs), required for derepression of phospholipid biosynthetic genes in response to inositol depletion
Aminoacid Sequence
Download FASTA
>YDR123C INO2
MQQATGNELLGILDLDNDIDFETAYQMLSSNFDDQMSAHIHENTFSATSPPLLTHELGII
PNVATVQPSHVETIPADNQTHHAPLHTHAHYLNHNPHQPSMGFDQALGLKLSPSSSGLLS
TNESNAIEQFLDNLISQDMMSSNASMNSESHLHIRSPKKQHRYTELNQRYPETHPHSNTG
ELPTNTADVPTEFTTREGPHQPIGNDHYNPPPFSVPEIRIPDSDIPANIEDDPVKVRKWK
HVQMEKIRRINTKEAFERLIKSVRTPPKENGKRIPKHILLTCVMNDIKSIRSANEALQHI
LDDS* 
Transcription Factor
Binding site(s)
ATGTGAAAT
CATGTGAAAT
WYTTCAYRTGS
CACATGC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator