Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ixr1p
Description Protein that binds DNA containing intrastrand cross-links formed by cisplatin, contains two HMG (high mobility group box) domains, which confer the ability to bend cisplatin-modified DNA; mediates aerobic transcriptional repression of COX5b
Aminoacid Sequence
Download FASTA
>YKL032C IXR1
MNTGISPKQDDASNSNLLNIGQDHSLQYQGLEHNDSQYRDASHQTPHQYLNQFQAQPQQQ
QQQQQQQQQQQQQAPYQGHFQQSPQQQQQNVYYPLPPQSLTQPTSQSQQQQQQQQQQQYA
NSNSNSNNNVNVNALPQDFGYMQQTGSGQNYPTINQQQFSEFYNSFLSHLTQKQTNPSVT
GTGASSNNNSNNNNVSSGNNSTSSNPAQLAASQLNPATAAAAAANNAAGPASYLSQLPQV
QRYYPNNMNALSSLLDPSSAGNAAGNANTATHPGLLPPNLQPQLTHHQQQMQQQLQLQQQ
QQLQQQQQLQQQHQLQQQQQLQQQHHHLQQQQQQQQHPVVKKLSSTQSRIERRKQLKKQG
PKRPSSAYFLFSMSIRNELLQQFPEAKVPELSKLASARWKELTDDQKKPFYEEFRTNWEK
YRVVRDAYEKTLPPKRPSGPFIQFTQEIRPTVVKENPDKGLIEITKIIGERWRELDPAKK
AEYTETYKKRLKEWESCYPDENDPNGNPTGHSHKAMNMNLNMDTKIMENQDSIEHITANA
IDSVTGSNSNSTNPNTPVSPPISLQQQPLQQQQQQQQQQQHMLLADPTTNGSIIKNE* 
Transcription Factor
Binding site(s)
KTTSAAYKGTTYASA
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator