Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Ixr1p
Description Protein that binds DNA containing intrastrand cross-links formed by cisplatin, contains two HMG (high mobility group box) domains, which confer the ability to bend cisplatin-modified DNA; mediates aerobic transcriptional repression of COX5b
Aminoacid Sequence
Download FASTA
>YKL032C IXR1
MNTGISPKQDDASNSNLLNIGQDHSLQYQGLEHNDSQYRDASHQTPHQYLNQFQAQPQQQ
QQQQQQQQQQQQQAPYQGHFQQSPQQQQQNVYYPLPPQSLTQPTSQSQQQQQQQQQQQYA
NSNSNSNNNVNVNALPQDFGYMQQTGSGQNYPTINQQQFSEFYNSFLSHLTQKQTNPSVT
GTGASSNNNSNNNNVSSGNNSTSSNPAQLAASQLNPATAAAAAANNAAGPASYLSQLPQV
QRYYPNNMNALSSLLDPSSAGNAAGNANTATHPGLLPPNLQPQLTHHQQQMQQQLQLQQQ
QQLQQQQQLQQQHQLQQQQQLQQQHHHLQQQQQQQQHPVVKKLSSTQSRIERRKQLKKQG
PKRPSSAYFLFSMSIRNELLQQFPEAKVPELSKLASARWKELTDDQKKPFYEEFRTNWEK
YRVVRDAYEKTLPPKRPSGPFIQFTQEIRPTVVKENPDKGLIEITKIIGERWRELDPAKK
AEYTETYKKRLKEWESCYPDENDPNGNPTGHSHKAMNMNLNMDTKIMENQDSIEHITANA
IDSVTGSNSNSTNPNTPVSPPISLQQQPLQQQQQQQQQQQHMLLADPTTNGSIIKNE* 
Transcription Factor
Binding site(s)
KTTSAAYKGTTYASA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator