Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Kar4p
Description Transcription factor required for gene regulation in response to pheromones; also required during meiosis; exists in two forms, a slower-migrating form more abundant during vegetative growth and a faster-migrating form induced by pheromone
Aminoacid Sequence
Download FASTA
>YCL055W KAR4
MAFQDPTYDQNKSRHINNSHLQGPNQETIEMKSKHVSFKPSRDFHTNDYSNNYIHGKSLP
QQHVTNIENRVDGYPKLQKLFQAKAKQINQFATTPFGCKIGIDSIVPTLNHWIQNENLTF
DVVMIGCLTENQFIYPILTQLPLDRLISKPGFLFIWANSQKINELTKLLNNEIWAKKFRR
SEELVFVPIDKKSPFYPGLDQDDETLMEKMQWHCWMCITGTVRRSTDGHLIHCNVDTDLS
IETKDTTNGAVPSHLYRIAENFSTATRRLHIIPARTGYETPVKVRPGWVIVSPDVMLDNF
SPKRYKEEIANLGSNIPLKNEIELLRPRSPVQKAQ* 
Transcription Factor
Binding site(s)
YAANNCAAANNCNGNYT
CTAANNCAAANNCNGNYT
TTAANNCAAANNCNGNYT
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator