Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Leu3p
Description Zinc-finger transcription factor that regulates genes involved in branched chain amino acid biosynthesis and ammonia assimilation; positively regulated by alpha-isopropylmalate, an intermediate in leucine biosynthesis
Aminoacid Sequence
Download FASTA
>YLR451W LEU3
MEGRSDFVATSQSGSEMSHSETRNRTGMNARKRKFACVECRQQKSKCDAHERAPEPCTKC
AKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNLTSDEILKKIEEEQEIVLDNSN
FTKEKVKQLRKSAFETTEIEPRSYKTLRGEPISYSTNRRHTDSSPLTLLSSSTNFDPVHS
TNVMTDDQLKCLPKSLGDVYLSSSDIAELFQEFATKYHQFLPVVDLSKGAERIYHLSPCL
FWVILLIGLRRKFGATDLMTRLSVLVKSVLSEITISPIIRYTPSDKDEPVLNVASVYSVQ
AFLLYTFWPPLTSSLSADTSWNTIGTAMFQALRVGLNCAGFSKEYASANSELVNEQIRTW
ICCNVVSQTVASSFGFPAYVSFDYLVISSIRVPNSKSQVDIPNELRQMAQIARFENQIVN
TMNSTPASVTGMVSQEEKQPLLHVLNQQLSQLEISLEENNLDDIRKFLLLVAKVHLLTYY
FTDVTSQSAGKSNGNIYEGSYSIMELDTSFETKRGLVKVYNAAVNFLIHANSMWEHDPTI
IKYFPGLFVLNIWQSACIISKLIHSSLHSMLDVNSGKKAYNNAISLTFNASVLKYDMAYR
SSGIMRSIWSLFANMYDAWKNDQKEGGGRLNNDFNLGITIKSRMSVNVFFDCLYILKEKC
GMAKLERETKVSTAYNVDEEEEEDEDEEGEEEEEEEELSSKVPENMDSQQLRTRKFTNVR
HPEKKARKIIETIPLDPNPINAGSTSSGSSLTTPNSQVANTISYRGILNKMSPREQLNHA
NLDSSVSTDIKDTEAVNEPLPIGRNAEHPANQPPLSITQMQENTLPATQANSSLLETYPI
VQSNPVTTTIKESPNSIMAGWDNWESDMVWRDVDILMNEFAFNPKV* 
Transcription Factor
Binding site(s)
CCGN{4}CGG
CCGGNNCCGG
CCGTTAACGG
acCGG
HtagxxtWCgCCGGTHxtDxa
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator