Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Lys14p
Description Transcriptional activator involved in regulation of genes of the lysine biosynthesis pathway; requires 2-aminoadipate semialdehyde as co-inducer
Aminoacid Sequence
Download FASTA
>YDR034C LYS14
MFESVNLDENSPEDRELAKVLSPPGSYLSPASLDSGSSFTNSGTSTSCFEPKNNLPSLSF
LNARAGSLGGIFNHKQMTSPSNSNIGGENVESTTSSNDGSNENAGHPTTSEQDQNADHPT
ISQADDNGHSSLTPNPAVTSTVTDKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCA
RLNRQCVYVLNPKNKKRRTSNAQRVKEFRKHSTSLDNDHNNARKRQHSSCKAEKKKKVRQ
NLSEDTTDPKPITDNGKNVPLDEIESLEIPNLDLTTTMNGYDVNLLMQNLNDMVNMKLHD
SYLLNEELKGLDLPDLDIPELLPASNVNSSVPISFLVNNVITFNTKLSSFKLGGIHDKYL
KIFYYDCLDSIAPFFQNQGNPLRDILLSFAKNEAYLLSSILATGASIAYRKSNNLEDERN
YCAYLSHCLSLLGEQFKNESNVLNRIEPIILTVIMLAWDCIYSMNSQWRSHLKGVTDLFK
KINAGNSSKVLNVAKCWFKVMETFASISTVFGGSLIDNNDLDAIFDPYDYQYVDSLKFLN
IMTPLNEFNLLRGHKEDFDLVIKEVFKSLNTIRSTEKNYFSKEEGLFTKKLDYLLLSSQT
SSEKSKDQISYFNTQKILVEIDKQLDYEFIDKSGIIPSDNQSHPRISNIHDNAIDMVTLK
NGEEVAISWYDISHQTQVLSFLLIVLLKLLGMPKESSTIQQVVKKIMSFFKFLDSDSPPQ
NSRTCYSNFAVLIAGLNAMDEETRAIVKRYYKINGGKFQKLTEHNLNRLEKVWYGKNQNY
RLEEQDVLTW* 
Transcription Factor
Binding site(s)
TCCRNYGGA
aaTtcCg
cxcaAAATTCCGBgcgxt
aATTCCGg
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator