Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Lys14p
Description Transcriptional activator involved in regulation of genes of the lysine biosynthesis pathway; requires 2-aminoadipate semialdehyde as co-inducer
Aminoacid Sequence
Download FASTA
>YDR034C LYS14
MFESVNLDENSPEDRELAKVLSPPGSYLSPASLDSGSSFTNSGTSTSCFEPKNNLPSLSF
LNARAGSLGGIFNHKQMTSPSNSNIGGENVESTTSSNDGSNENAGHPTTSEQDQNADHPT
ISQADDNGHSSLTPNPAVTSTVTDKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCA
RLNRQCVYVLNPKNKKRRTSNAQRVKEFRKHSTSLDNDHNNARKRQHSSCKAEKKKKVRQ
NLSEDTTDPKPITDNGKNVPLDEIESLEIPNLDLTTTMNGYDVNLLMQNLNDMVNMKLHD
SYLLNEELKGLDLPDLDIPELLPASNVNSSVPISFLVNNVITFNTKLSSFKLGGIHDKYL
KIFYYDCLDSIAPFFQNQGNPLRDILLSFAKNEAYLLSSILATGASIAYRKSNNLEDERN
YCAYLSHCLSLLGEQFKNESNVLNRIEPIILTVIMLAWDCIYSMNSQWRSHLKGVTDLFK
KINAGNSSKVLNVAKCWFKVMETFASISTVFGGSLIDNNDLDAIFDPYDYQYVDSLKFLN
IMTPLNEFNLLRGHKEDFDLVIKEVFKSLNTIRSTEKNYFSKEEGLFTKKLDYLLLSSQT
SSEKSKDQISYFNTQKILVEIDKQLDYEFIDKSGIIPSDNQSHPRISNIHDNAIDMVTLK
NGEEVAISWYDISHQTQVLSFLLIVLLKLLGMPKESSTIQQVVKKIMSFFKFLDSDSPPQ
NSRTCYSNFAVLIAGLNAMDEETRAIVKRYYKINGGKFQKLTEHNLNRLEKVWYGKNQNY
RLEEQDVLTW* 
Transcription Factor
Binding site(s)
TCCRNYGGA
aaTtcCg
cxcaAAATTCCGBgcgxt
aATTCCGg
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator