Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Mcm1p
Description Transcription factor involved in cell-type-specific transcription and pheromone response; plays a central role in the formation of both repressor and activator complexes
Aminoacid Sequence
Download FASTA
>YMR043W MCM1
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY* 
Transcription Factor
Binding site(s)
TTACCNAATTNGGTAA
TTWCCYAAWNNGGWAAWW
DCCYWWWNNRG
CCYWWWNNRG
CCTAATTAGG
atttCCgaWWtgGGaaaxa
ccxaaWxxRg
TtMStaaW
aAATtaSK
AAttaSKa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator