Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mcm1p
Description Transcription factor involved in cell-type-specific transcription and pheromone response; plays a central role in the formation of both repressor and activator complexes
Aminoacid Sequence
Download FASTA
>YMR043W MCM1
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY* 
Transcription Factor
Binding site(s)
TTACCNAATTNGGTAA
TTWCCYAAWNNGGWAAWW
DCCYWWWNNRG
CCYWWWNNRG
CCTAATTAGG
atttCCgaWWtgGGaaaxa
ccxaaWxxRg
TtMStaaW
aAATtaSK
AAttaSKa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator