Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Met31p
Description Zinc-finger DNA-binding protein, involved in transcriptional regulation of the methionine biosynthetic genes, similar to Met32p
Aminoacid Sequence
Download FASTA
>YPL038W MET31
MKLAQDMNVDEIFLKQAAEAIAVISSSPTHTDPIIRELLHRIRQSSPLSAVIPAPENVLK
AGEPENMARGLIRIPETQTKRTGGNNHSKEGAQLYSCAKCQLKFSRSSDLRRHEKVHSLV
LPHICSNCGKGFARKDALKRHSNTLTCQRNRKKLSEGSDVDVDELIKDAIKNGTGLL* 
Transcription Factor
Binding site(s)
AAACTGTGG
AAACTGTG
CTGTGGC
cGCCACaxH
tgcCACag
cCACagtg
YACagYgM
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator