Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Met32p
Description Zinc-finger DNA-binding protein, involved in transcriptional regulation of the methionine biosynthetic genes, similar to Met31p
Aminoacid Sequence
Download FASTA
>YDR253C MET32
MEDQDAAFIKQATEAIVDVSLNIDNIDPIIKELLERVRNRQNRLQNKKPALIPAENGVDI
NSQGGNIKVKKENALPKPPKSSKSKPQDRRNSTGEKRFKCAKCSLEFSRSSDLRRHEKTH
FAILPNICPQCGKGFARKDALKRHYDTLTCRRNRTKLLTAGGEGINELLKKVKQSNIVHR
QDNNHNGSSNG* 
Transcription Factor
Binding site(s)
AAACTGTGG
AAACTGTG
CTGTGGC
axtGtGGcg
axtGTGGcgB
aaSTGTGGCGYc
tGTGGCg
tGTGGcDB
aBtGTGGc
caBtGTGg
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator