Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mga1p
Description Protein similar to heat shock transcription factor; multicopy suppressor of pseudohyphal growth defects of ammonium permease mutants
Aminoacid Sequence
Download FASTA
>YGR249W MGA1
MQPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFV
RQLHMYGFHKLSHPSPDQSSANNGNVKELVEWKFTHPSGFFFKEANAGILNKIQRKSTGV
GKDGKRKNILSPISVSYVDASRLNVLSQQSGPVSAREPSNMFMGSPVHYSTSQSPPHISI
PQQQQSSGPYLISSLPPQQPTVNMMRRQSISARMMNSYDYPNQFSTQDSIVQPQQPQQVL
SPQALSGPPMKKSGTLSSTDDLKTTSLPIVNYPMPYHPGAFAQQQQQQQQPLPTVPPYSS
YSTPFPSMMNSLSNSASNSPALGVCNNNVTLPKKSNISERQALDNHIQTLKNSLSTITDL
IEKHINSASQDENKTLTNDAMNKDLRTSLSLLQNSKEEIIQLESKWMSMQSVKTTALPLQ
ETTNTSSTLTSLTSSIIPKSIPIITKGEVATKPASY* 
Transcription Factor
Binding site(s)
TTCBxt
ttDDaRTGTTCtaTaxxxcH
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator