Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mig2p
Description Protein containing zinc fingers, involved in repression, along with Mig1p, of SUC2 (invertase) expression by high levels of glucose; binds to Mig1p-binding sites in SUC2 promoter
Aminoacid Sequence
Download FASTA
>YGL209W MIG2
MPKKQTNFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSD
ELKRHMRTHTGQSQRRLKKASVQKQEFLTVSGIPTIASGVMIHQPIPQVLPANMAINVQA
VNGGNIIHAPNAVHPMVIPIMAQPAPIHASAASFQPATSPMPISTYTPVPSQSFTSFQSS
IGSIQSNSDVSSIFSNMNVRVNTPRSVPNSPNDGYLHQQHIPQQYQHQTASPSVAKQQKT
FAHSLASALSTLQKRTPVSAPSTTIESPSSPSDSSHTSASSSAISLPFSNAPSQLAVAKE
LESVYLDSNRYTTKTRRERAKFEIPEEQEEDTNNSSSGSNEEEHESLDHESSKSRKKLSG
VKLPPVRNLLKQIDVFNGPKRV* 
Transcription Factor
Binding site(s)
AATTRTCCGGGG
TATAGTGCGGGG
ATTTTTGTGGGG
GAATAYCTGGGG
TTATTTCTGGGG
TAAAAGCCGGGG
TTAAAAGCGGGG
TTAAACGTGGGG
ATAAAACTGGGG
ATAAACGCGGGG
ATTAATGTGGGG
AAAAATGCGGGG
ATTTTGCGGGG
CCCCRca
CCCCRC
YgxgHtaCCCCGCAHttxxB
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator