Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Mig2p
Description Protein containing zinc fingers, involved in repression, along with Mig1p, of SUC2 (invertase) expression by high levels of glucose; binds to Mig1p-binding sites in SUC2 promoter
Aminoacid Sequence
Download FASTA
>YGL209W MIG2
MPKKQTNFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSD
ELKRHMRTHTGQSQRRLKKASVQKQEFLTVSGIPTIASGVMIHQPIPQVLPANMAINVQA
VNGGNIIHAPNAVHPMVIPIMAQPAPIHASAASFQPATSPMPISTYTPVPSQSFTSFQSS
IGSIQSNSDVSSIFSNMNVRVNTPRSVPNSPNDGYLHQQHIPQQYQHQTASPSVAKQQKT
FAHSLASALSTLQKRTPVSAPSTTIESPSSPSDSSHTSASSSAISLPFSNAPSQLAVAKE
LESVYLDSNRYTTKTRRERAKFEIPEEQEEDTNNSSSGSNEEEHESLDHESSKSRKKLSG
VKLPPVRNLLKQIDVFNGPKRV* 
Transcription Factor
Binding site(s)
AATTRTCCGGGG
TATAGTGCGGGG
ATTTTTGTGGGG
GAATAYCTGGGG
TTATTTCTGGGG
TAAAAGCCGGGG
TTAAAAGCGGGG
TTAAACGTGGGG
ATAAAACTGGGG
ATAAACGCGGGG
ATTAATGTGGGG
AAAAATGCGGGG
ATTTTGCGGGG
ccCCRca
CCCCRC
YgxgHtaCCCCGCAHttxxB
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator