Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Mig3p
Description Probable transcriptional repressor involved in response to toxic agents such as hydroxyurea that inhibit ribonucleotide reductase; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genes
Aminoacid Sequence
Download FASTA
>YER028C MIG3
MNYLRDRFPPDNDQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSD
ELKRHLRTHTKGVQRRRIKSKGSRKTVVNTATAAPTTFNENTGVSLTGIGQSKVPPILIS
VAQNCDDVNIRNTGNNNGIVETQAPAILVPVINIPNDPHPIPSSLSTTSITSIASVYPST
SPFQYLKSGFPEDPASTPYVHSSGSSLALGELSSNSSIFSKSRRNLAAMSGPDSLSSSKN
QSSASLLSQTSHPSKSFSRPPTDLSPLRRIMPSVNTGDMEISRTVSVSSSSSSLTSVTYD
DTAAKDMGMGIFFDRPPVTQKACRSNHKYKVNAVSRGRQHERAQFHISGDDEDSNVHRQE
SRASNTSPNVSLPPIKSILRQIDNFNSAPSYFSK* 
Transcription Factor
Binding site(s)
AATTRTCCGGGG
TATAGTGCGGGG
ATTTTTGTGGGG
GAATAYCTGGGG
TTATTTCTGGGG
TAAAAGCCGGGG
TTAAAAGCGGGG
TTAAACGTGGGG
ATAAAACTGGGG
ATAAACGCGGGG
ATTAATGTGGGG
AAAAATGCGGGG
ATTTTGCGGGG
ccCCRca
acxxgttACCCCGCAtttaxt
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator