Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mot2p
Description Subunit of the CCR4-NOT complex, which has roles in transcription regulation, mRNA degradation, and post-transcriptional modifications; with Ubc4p, ubiquitinates nascent polypeptide-associated complex subunits and histone demethyase Jhd2p
Aminoacid Sequence
Download FASTA
>YER068W MOT2
MMNPHVQENLQAIHNALSNFDTSFLSEDEEDYCPLCIEPMDITDKNFFPCPCGYQICQFC
YNNIRQNPELNGRCPACRRKYDDENVRYVTLSPEELKMERAKLARKEKERKHREKERKEN
EYTNRKHLSGTRVIQKNLVYVVGINPPVPYEEVAPTLKSEKYFGQYGKINKIVVNRKTPH
SNNTTSEHYHHHSPGYGVYITFGSKDDAARCIAQVDGTYMDGRLIKAAYGTTKYCSSYLR
GLPCPNPNCMFLHEPGEEADSFNKRELHNKQQAQQQSGGTAFTRSGIHNNISTSTAGSNT
NLLSENFTGTPSPAAMRAQLHHDSHTNAGTPVLTPAPVPAGSNPWGVTQSATPVTSINLS
KNSSSINLPTLNDSLGHHTTPTTENTITSTTTTTNTNATSHSHGSKKKQSLAAEEYKDPY
DALGNAVDFLDARLHSLSNYQKRPISIKSNIIDEETYKKYPSLFSWDKIEASKKSDNTLA
NKLVEILAIKPIDYTASVVQFLQSVNVGVNDNITITDNTKTPTQPIRLQTVSQQIQPPLN
VSTPPPGIFGPQHKVPIQQQQMGDTSSRNSSDLLNQLINGRKIIAGN* 
Transcription Factor
Binding site(s)
ATATA
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator