Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Msn4p
Description Transcriptional activator related to Msn2p; activated in stress conditions, which results in translocation from the cytoplasm to the nucleus; binds DNA at stress response elements of responsive genes, inducing gene expression
Aminoacid Sequence
Download FASTA
>YKL062W MSN4
MLVFGPNSSFVRHANKKQEDSSIMNEPNGLMDPVLSTTNVSATSSNDNSANNSISSPEYT
FGQFSMDSPHRTDATNTPILTATTNTTANNSLMNLKDTASLATNWKWKNSNNAQFVNDGE
KQSSNANGKKNGGDKIYSSVATPQALNDELKNLEQLEKVFSPMNPINDSHFNENIELSPH
QHATSPKTNLLEAEPSIYSNLFLDARLPNNANSTTGLNDNDYNLDDTNNDNTNSMQSILE
DFVSSEEALKFMPDAGRDARRYSEVVTSSFPSMTDSRNSISHSIEFWNLNHKNSSNSKPT
QQIIPEGTATTERRGSTISPTTTINNSNPNFKLLDHDVSQALSGYSMDFSKDSGITKPKS
ISSSLNRISHSSSTTRQQRASLPLIHDIESFANDSVMANPLSDSASFLSEENEDDAFGAL
NYNSLDATTMSAFDNNVDPFNILKSSPAQDQQFIKPSMMLSDNASAAAKLATSGVDNITP
TPAFQRRSYDISMNSSFKILPTSQAHHAAQHHQQQPTKQATVSPNTRRRKSSSVTLSPTI
SHNNNNGKVPVQPRKRKSITTIDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTER
PFACMFCEKKFSRSDNLSQHLKTHKKHGDF* 
Transcription Factor
Binding site(s)
AGGGG
CCCCT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator