Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mss11p
Description Transcription factor involved in regulation of invasive growth and starch degradation; controls the activation of MUC1 and STA2 in response to nutritional signals
Aminoacid Sequence
Download FASTA
>MSS11 YMR164C
MDNTTNINTNERSSNTDFSSAPNIKGLNSHTQLQFDADSRVFVSDVMAKNSKQLLYAHIY
NYLIKNNYWNSAAKFLSEADLPLSRINGSASGGKTSLNASLKQGLMDIASKGDIVSEDGL
LPSKMLMDANDTFLLEWWEIFQSLFNGDLESGYQQDHNPLRERIIPILPANSKSNMPSHF
SNLPPNVIPPTQNSFPVSEESFRPNGDGSNFNLNDPTNRNVSERFLSRTSGVYDKQNSAN
FAPDTAINSDIAGQQYATINLHKHFNDLQSPAQPQQSSQQQIQQPQHQPQHQPQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQHQQQQQTPYPIVNPQMVPHIPSENSHSTGLMPSVPPT
NQQFNAQTQSSMFSDQQRFFQYQLHHQNQGQAPSFQQSQSGRFDDMNAMKMFFQQQALQQ
NSLQQNLGNQNYQSNTRNNTAEETTPTNDNNANGNSLLQEHIRARFNKMKTIPQQMKNQS
TVANPVVSDITSQQQYMHMMMQRMAANQQLQNSAFPPDTNRIAPANNTMPLQPGNMGSPV
IENPGMRQTNPSGQNPMINMQPLYQNVSSAMHAFAPQQQFHLPQHYKTNTSVPQNDSTSV
FPLPNNNNNNNNNNNNNNNNNSNNSNNNNNNNNNNNNSNNTPTVSQPSSKCTSSSSTTPN
ITTTIQPKRKQRVGKTKTKESRKVAAAQKVMKSKKLEQNGDSAATNFINVTPKDSGGKGT
VKVQNSNSQQQLNGSFSMDTETFDIFNIGDFSPDLMDS* 
Transcription Factor
Binding site(s)
TTTGCN{97}GCAAA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator